A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10046 |
| Swiss-prot Accession number | P83587 (Sequence in FASTA format) |
| Description | Pigment-dispersing hormone C (PDH C) (Light-adapting distal retinalpigment hormone C) (DRPH C). |
| Source organism | Orconectes limosus (Spinycheek crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod PDH family. |
| Tissue Specificity | Eyestalk sinus gland |
| Post translational modification | N/A |
| Function | Causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator |
| Protein Length | 18 Amino acids |
| Molecular weight | 1858 |
| References | 1 PubMed abstract 14981133 |
| Domain Name | N/A |
| Hormone Name | Pigment-dispersing hormone C |
| Mature Hormone Sequence | NSELINAILGSPTLMGEV |
| Position of mature hormone in Pre-Hormone protein | 18 Residues from position (1-18) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10091 |
| Swiss-prot Accession number | Q25589 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones A precursor (CHH A) [Contains: CHHprecursor-related peptide A (CPRP A); Crustacean hyperglycemic hormone(CHH)]. |
| Source organism | Orconectes limosus (Spinycheek crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 135 Amino acids |
| Molecular weight | 15086 |
| References | 1 PubMed abstract 7925379 2 PubMed abstract 1788131 3 PubMed abstract 1800954 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone |
| Mature Hormone Sequence | QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (62-133) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10092 |
| Swiss-prot Accession number | Q25588 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones A* precursor (CHH A*) [Contains: CHHprecursor-related peptide A* (CPRP A*); Crustacean hyperglycemichormone (CHH)]. |
| Source organism | Orconectes limosus (Spinycheek crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 135 Amino acids |
| Molecular weight | 15099 |
| References | 1 PubMed abstract 7925379 2 PubMed abstract 1788131 3 PubMed abstract 1800954 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone |
| Mature Hormone Sequence | QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (62-133) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10130 |
| Swiss-prot Accession number | P83636 (Sequence in FASTA format) |
| Description | Molt-inhibiting hormone precursor (MIH). |
| Source organism | Orconectes limosus (Spinycheek crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Sinus gland of the eyestalk |
| Post translational modification | N/A |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
| Protein Length | 106 Amino acids |
| Molecular weight | 12135 |
| References | 1 PubMed abstract 16269348 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Molt-inhibiting hormone |
| Mature Hormone Sequence | RYVFEECPGVMGNRALHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA |
| Position of mature hormone in Pre-Hormone protein | 75 Residues from position (30-104) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10508 |
| Swiss-prot Accession number | P83586 (Sequence in FASTA format) |
| Description | Pigment-dispersing hormone B (PDH B) (Light-adapting distal retinalpigment hormone B) (DRPH B). |
| Source organism | Orconectes limosus (Spinycheek crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod PDH family. |
| Tissue Specificity | Eyestalk sinus gland |
| Post translational modification | N/A |
| Function | Causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator |
| Protein Length | 18 Amino acids |
| Molecular weight | 1874 |
| References | 1 PubMed abstract 14981133 |
| Domain Name | N/A |
| Hormone Name | Pigment-dispersing hormone B |
| Mature Hormone Sequence | NSELINAILGSPTLFGEV |
| Position of mature hormone in Pre-Hormone protein | 18 Residues from position (1-18) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10697 |
| Swiss-prot Accession number | P37085 (Sequence in FASTA format) |
| Description | Pigment-dispersing hormone A precursor [Contains: PDH precursor-related peptide (PRPP); Pigment-dispersing hormone A (PDH A) (Light-adapting distal retinal pigment hormone A) (DRPH A)]. |
| Source organism | Orconectes limosus (Spinycheek crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod PDH family. |
| Tissue Specificity | Optical ganglia of the eyestalk |
| Post translational modification | N/A |
| Function | Causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator |
| Protein Length | 76 Amino acids |
| Molecular weight | 8281 |
| References | 1 PubMed abstract 8477858 |
| Domain Name | Pigment_DH |
| Hormone Name | Pigment-dispersing hormone A |
| Mature Hormone Sequence | GPHKRNSELINSILGLPKVMNEA |
| Position of mature hormone in Pre-Hormone protein | 18 Residues from position (56-73) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |